PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc00_g08160
Common NameGSCOC_T00000290001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family NF-YC
Protein Properties Length: 278aa    MW: 30652.8 Da    PI: 4.9553
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc00_g08160genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC58.41.5e-186861898
        NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                 ++++P arikki++adedv +i+  +Pvl+ska elf+ +l  r++  + +   +t+    ++ +v++ ++fdfl ++v +
  Cc00_g08160  6 DTRFPAARIKKIMQADEDVGKIAMAVPVLVSKALELFLQDLCDRTYDITLQRGAKTVSSLHLKHCVQSYNVFDFLREVVSK 86
                 5789************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.5E-26372IPR009072Histone-fold
SuperFamilySSF471132.1E-20489IPR009072Histone-fold
PfamPF008081.5E-19871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MRKKLDTRFP AARIKKIMQA DEDVGKIAMA VPVLVSKALE LFLQDLCDRT YDITLQRGAK  60
TVSSLHLKHC VQSYNVFDFL REVVSKVPDY GHSDAASADM SKRRKILPEE YNDSDEEFRK  120
NRMEVCHSSS SGRGRGRGRG RGRGRSSRIT DREAIRHENE SESSMSIQQS SKQISSPGST  180
ADTLAELESS KENIKSSDND NVLQNIDLNS GVGEGGDKTA ATLTEPSTSS AGPADTKGEE  240
YPGWALSEMD RMAIDPSQIA HLSSRLDEEE EDYDEEG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A7e-23272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134143RGRGRGRGRG
2134144RGRGRGRGRGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012830670.15e-98PREDICTED: dr1-associated corepressor-like
TrEMBLA0A068VF770.0A0A068VF77_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000085187e-92(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA79602230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.11e-67nuclear factor Y, subunit C11